6NMYABCM

A cytokine-receptor complex
M: 45-49,89-93
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain M piercings
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
view details
Other Other 54% -A +270B +322B +34C -80C +91C +240C -295M
Interpreting sequences
Chain A Sequence
EETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQP
Chain A Sequence
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLQVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDT
Chain A Sequence
EETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQP
Chain A Sequence
TNLRMKAKAQQLTWDLNR---DIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPP---WILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQ
sequence length 215,196,215,268
structure length 215,196,215,262
publication title Signalling conformation of cell surface receptor
rcsb
molecule tags Cytokine
molecule keywords Interleukin-3 receptor subunit alpha
source organism Homo sapiens
missing residues M: 45-49,89-93
pdb deposition date2019-01-13
LinkProt deposition date2020-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling