| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
| view details |
|
Hopf.1 | 71% | -A | +227B | +45A +180A -228A | ||||||||
Chain A Sequence |
MAVQIGFLLFPEVQQLDLTGPHDVLASLPDVQVHLIWKEPGPVVASSGLVLQATTSFADCPPLDVICIPGGTGVGALMEDPQALAFIRQQAARARYVTSVCTGSLVLGAAGLLQGKRATTHWAYHELLAPLGAIPVHERVVRDGNLLTGAGITAGIDFALTLAAELFDAATAQRVQLQLEYAPAPPFNAGSPDTAPASVVQQARQRAADSLHKRREITLRAAARLAA |
Chain A Sequence |
SHMAVQIGFLLFPEVQQLDLTGPHDVLASLPDVQVHLIWKEPGPVVASSGLVLQATTSFADCPPLDVICIPGGTGVGALMEDPQALAFIRQQAARARYVTSVCTGSLVLGAAGLLQGKRATTHWAYHELLAPLGAIPVHERVVRDGNLLTGAGITAGIDFALTLAAELFDAATAQRVQLQLEYAPAPPFNAGSPDTAPASVVQQARQRAADSLHKRREITLRAAARLAA |
| sequence length | 227,229 |
| structure length | 227,229 |
| publication title |
Mix-and-inject XFEL crystallography reveals gated conformational dynamics during enzyme catalysis
rcsb |
| molecule tags | Lyase |
| molecule keywords | Isonitrile hydratase InhA |
| source organism | Pseudomonas fluorescens (strain atcc baa-477 / nrrl b-23932 / pf-5) |
| pdb deposition date | 2018-12-26 |
| LinkProt deposition date | 2019-11-28 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
