6NI2AHLV

Stabilized beta-arrestin 1-v2t subcomplex of a gpcr-g protein-beta-arrestin mega-complex
Link type Probability Loop ranges Chain A piercings Chain H piercings Chain L piercings Chain V piercings
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
view details
Other Other 35% -A +108V +113A -369L -113V
Interpreting sequences
Chain A Sequence
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYADSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVS
Chain A Sequence
VQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTV
Chain A Sequence
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEI
Chain A Sequence
DECALAKD
sequence length 113,117,107,14
structure length 113,117,107,8
publication title Structure of an Endosomal Signaling GPCR-G Protein-beta-arrestin Mega-Complex
doi rcsb
molecule tags Signaling protein/immune system
molecule keywords Nanobody 32
source organism Lama glama
pdb deposition date2018-12-26
LinkProt deposition date2019-11-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling