6M2CCDGH

Distinct mechanism of mul1-ring domain simultaneously recruiting e2 enzyme and the substrate p53-tad domain
Link type Probability Chain C piercings Chain D piercings Chain G piercings Chain H piercings
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
view details
Other Other 33% -147D -147G +352H +147C -352C -148D
Interpreting sequences
Chain C Sequence
GSMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Chain C Sequence
GSMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Chain C Sequence
LKSACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS
Chain C Sequence
LKSACVVCLSSFKSCVFLECGHVCSCTECYRALPEPKKCPICRQAITRVIPLYNS
sequence length 149,149,55,55
structure length 149,149,55,55
publication title Distinct mechanism of MUL1-RING domain simultaneously recruiting E2 enzyme and the substrate p53-TAD domain
rcsb
molecule tags Transferase
molecule keywords Ubiquitin-conjugating enzyme E2 D2
source organism Homo sapiens
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
ec 2.3.2.24: (E3-independent) E2 ubiquitin-conjugating enzyme.
ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
ec 2.3.2.24: (E3-independent) E2 ubiquitin-conjugating enzyme.
pdb deposition date2020-02-27
LinkProt deposition date2021-04-14

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
CDGH PF13920 zf-C3HC4_3Zinc finger, C3HC4 type (RING finger)
CDGH PF13920 zf-C3HC4_3Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling