6LNTBMPQ

Cryo-em structure of immature zika virus in complex with human antibody dv62.5 fab
Link type Probability Loop ranges Chain B piercings Chain M piercings Chain P piercings Chain Q piercings
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
view details
Other Other 31% -B +117M +309P -334P +392P
Interpreting sequences
Chain B Sequence
RCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA
Chain B Sequence
PFGGLKRLPAGLLLGHGPIRMVLAILAFLRFTAIKPSLGLINRWGSVGKKEAMEIIKKFKKDLAAMLRIINARKEKKRRGADTSVGIVGLLLTTAM
Chain B Sequence
QVQLVQSGAEVKKPGASLKVSCKASGYTFTSYGLSWVRQAPGQGLEWMGWITPYNGNTKYTQKLQGRVTMTTDTSTSTVYMELRSLRSDDTAVYYCARDSGTYAFYFDYWGQGTLVTVSS
Chain B Sequence
SYELTQPLSVSVALGQTASITCGGNNIGSKNVHWYQQKPGQAPVLVIYKYVNRPSGIPERFSGSNSGNTATLTISRAQAGDEADYYCQVWDSSTYVFGTGTKVTVL
sequence length 503,96,120,106
structure length 503,96,120,106
publication title Capsid protein structure in Zika virus reveals the flavivirus assembly process.
pubmed doi rcsb
molecule tags Virus
molecule keywords Envelope protein
source organism Homo sapiens
pdb deposition date2020-01-02
LinkProt deposition date2020-02-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling