6JFVABD

The crystal structure of tetrameric 2b-2b complex from keratins 5 and 14 (c367a mutant of k14)
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain D piercings
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
view details
Hopf.2 U Ring Hopf.2 U Ring 44% -A -463B -362D +376D -419D +426B -476B
Interpreting sequences
Chain A Sequence
GKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYAMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLL
Chain A Sequence
TKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG
Chain A Sequence
LRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG
sequence length 93,95,98
structure length 93,95,98
publication title Structural insight into intermediate filament assembly and structure gained from the crystal structure of a keratin heterotypic complex
rcsb
molecule tags Cytosolic protein
molecule keywords Keratin, type I cytoskeletal 14
source organism Homo sapiens
pdb deposition date2019-02-12
LinkProt deposition date2020-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling