6JCLACEH

Crystal structure of cofactor-bound rv0187 from mtb
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain E piercings Chain H piercings
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
view details
Other Other 36% -A +158H +166H +209H +223A +223A +223A
Interpreting sequences
Chain A Sequence
QQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVREN
Chain A Sequence
QQPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVR
Chain A Sequence
QPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVREN
Chain A Sequence
QPNPPDVDAFLDSTLVGDDPALAAALAASDAAELPRIAVSAQQGKFLCLLAGAIQARRVLEIGTLGGFSTIWLARGAGPQGRVVTLEYQPKHAEVARVNLQRAGVADRVEVVVGPALDTLPTLAGGPFDLVFIDADKENNVAYIQWAIRLARRGAVIVVDNVIRGGGILAESDDADAVAARRTLQMMGEHPGLDATAIQTVGRKGWDGFALALVRE
sequence length 218,216,217,216
structure length 218,216,217,216
publication title Structural and biochemical characterization of Rv0187, an O-methyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Probable O-methyltransferase
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
pdb deposition date2019-01-29
LinkProt deposition date2019-12-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling