6IPVABCD

Crystal structure of cqsb2 from streptomyces exfoliatus 2419-svt2 (apo form)
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
view details
Other Other 42% -A -60B +81B +164B -205B +223B -21C -61C +77C +125C -147C +163C -206C +223C +223C -222D -223A
Interpreting sequences
Chain A Sequence
SQRVPDESGLAQNYVLDRSDLQGLDLVWNENTGMDDMMKLMESKTKETYDHGEIFGQYCSLAEHINVPYDIVFEYAANARSLEEWTYSIRNMKHLGGGLYRADEMIQPNTDIYIRAEAQKGPEHGLVVYPCAWDQGHELWMRYYMTIIDSSKVLDKPGTVVLWTNCKHPYYDRSTENVPDYIAEGRARTDRVWVGDIWPVFHAGHSIEMGNLKRILEHRFG
Chain A Sequence
SQRVPDESGLAQNYVLDRSDLQGLDLVWNENTGMDDMMKLMESKTKETYDHGEIFGQYCSLAEHINVPYDIVFEYAANARSLEEWTYSIRNMKHLGGGLYRADEMIQPNTDIYIRAEAQKGPEHGLVVYPCAWDQGHELWMRYYMTIIDSSKVLDKPGTVVLWTNCKHPYYDRSTENVPDYIAEGRARTDRVWVGDIWPVFHAGHSIEMGNLKRILEHRFG
Chain A Sequence
SQRVPDESGLAQNYVLDRSDLQGLDLVWNENTGMDDMMKLMESKTKETYDHGEIFGQYCSLAEHINVPYDIVFEYAANARSLEEWTYSIRNMKHLGGGLYRADEMIQPNTDIYIRAEAQKGPEHGLVVYPCAWDQGHELWMRYYMTIIDSSKVLDKPGTVVLWTNCKHPYYDRSTENVPDYIAEGRARTDRVWVGDIWPVFHAGHSIEMGNLKRILEHRFG
Chain A Sequence
SQRVPDESGLAQNYVLDRSDLQGLDLVWNENTGMDDMMKLMESKTKETYDHGEIFGQYCSLAEHINVPYDIVFEYAANARSLEEWTYSIRNMKHLGGGLYRADEMIQPNTDIYIRAEAQKGPEHGLVVYPCAWDQGHELWMRYYMTIIDSSKVLDKPGTVVLWTNCKHPYYDRSTENVPDYIAEGRARTDRVWVGDIWPVFHAGHSIEMGNLKRILEHRFG
sequence length 221,221,221,221
structure length 221,221,221,221
publication title An Unprecedented Cyclization Mechanism in the Biosynthesis of Carbazole Alkaloids in Streptomyces.
pubmed doi rcsb
molecule tags Biosynthetic protein
molecule keywords CqsB2
source organism Streptomyces exfoliatus
pdb deposition date2018-11-05
LinkProt deposition date2019-10-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling