6IMCABCD

Crystal structure of alkbh1 in complex with mn(ii) and n-oxalylglycine
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
view details
Other Other 35% -A -358D -359A
Interpreting sequences
Chain A Sequence
EDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAERVGLEPVSKWRAYGLEGYPGFIFIPNPFLPGCQRHWVKQCLKLYSQKPNVCNLDKHMTKEETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNWDSKKYSADHYTPFPSDLAFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLKRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGECLPHCLETPLPAVLPSNSLVEPCSVEDWQVCATYLRTARVNMTVRQVLATGQDFPLEPV
Chain A Sequence
EDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAERVGLEPVSKWRAYGLEGYPGFIFIPNPFLPGCQRHWVKQCLKLYSQKPNVCNLDKHMTKEETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNWDSKKYSADHYTPFPSDLAFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLKRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGECLPHCLETPLPAVLPSNSLVEPCSVEDWQVCATYLRTARVNMTVRQVLATGQDFPLEPV
Chain A Sequence
EDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAERVGLEPVSKWRAYGLEGYPGFIFIPNPFLPGCQRHWVKQCLKLYSQKPNVCNLDKHMTKEETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNWDSKKYSADHYTPFPSDLAFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLKRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGECLPHCLETPLPAVLPSNSLVEPCSVEDWQVCATYLRTARVNMTVRQVLATGQDFPLEPV
Chain A Sequence
REDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAERVGLEPVSKWRAYGLEGYPGFIFIPNPFLPGCQRHWVKQCLKLYSQKPNVCNLDKHMTKEETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNWDSKKYSADHYTPFPSDLAFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLKRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGECLPHCLETPLPAVLPSNSLVEPCSVEDWQVCATYLRTARVNMTVRQVLATGQDFPLEPV
sequence length 339,339,339,340
structure length 339,339,339,340
publication title Crystal structure of Protein ZM
rcsb
molecule tags Gene regulation
molecule keywords Nucleic acid dioxygenase ALKBH1
source organism Mus musculus
pdb deposition date2018-10-22
LinkProt deposition date2020-01-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling