6IKMAFKM

Crystal structure of spue-spermidine in complex with scfv5
Link type Probability Loop ranges Chain A piercings Chain F piercings Chain K piercings Chain M piercings
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
view details
Other Other 85% -A -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M -363K -362M
Interpreting sequences
Chain A Sequence
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK
Chain A Sequence
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK
Chain A Sequence
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK
Chain A Sequence
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK
sequence length 335,335,335,335
structure length 335,335,335,335
publication title A Potent Anti-SpuE Antibody Allosterically Inhibits Type III Secretion System and Attenuates Virulence of Pseudomonas Aeruginosa.
pubmed doi rcsb
molecule tags Antimicrobial protein
molecule keywords Polyamine transport protein
source organism Pseudomonas aeruginosa
pdb deposition date2018-10-16
LinkProt deposition date2019-12-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling