| Link type | Probability | Loop ranges | Chain A piercings | Chain F piercings | Chain K piercings | Chain M piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
| view details |
|
Other | 85% | -A | -363F -363F -363F -76K -282K -363K +80M +109M -273M -310M | -363K -362M | ||||||||||
Chain A Sequence |
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK |
Chain A Sequence |
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK |
Chain A Sequence |
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK |
Chain A Sequence |
SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK |
| sequence length | 335,335,335,335 |
| structure length | 335,335,335,335 |
| publication title |
A Potent Anti-SpuE Antibody Allosterically Inhibits Type III Secretion System and Attenuates Virulence of Pseudomonas Aeruginosa.
pubmed doi rcsb |
| molecule tags | Antimicrobial protein |
| molecule keywords | Polyamine transport protein |
| source organism | Pseudomonas aeruginosa |
| pdb deposition date | 2018-10-16 |
| LinkProt deposition date | 2019-12-28 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
