6IJRABCD

Human ppargamma ligand binding domain complexed with sb1495
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
view details
Other Other 37% -A +289D +466D +477A +477A -696C -477D
Interpreting sequences
Chain A Sequence
ISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Chain A Sequence
HKILHRLLQ
Chain A Sequence
AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Chain A Sequence
HKILHRLLQE
sequence length 281,9,283,10
structure length 281,9,283,10
publication title Structural basis for the inhibitory effects of a novel reversible covalent ligand on PPAR gamma phosphorylation.
pubmed doi rcsb
molecule tags Transcription
molecule keywords Peroxisome proliferator-activated receptor gamma
source organism Homo sapiens
pdb deposition date2018-10-11
LinkProt deposition date2019-10-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling