6IFMCDFH

Crystal structure of dna bound vapbc from salmonella typhimurium
Link type Probability Loop ranges Chain C piercings Chain D piercings Chain F piercings Chain H piercings
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
view details
Other Other 30% -C -69H -82C -68F -133H -30C +69C -30D +40D
Interpreting sequences
Chain C Sequence
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Chain C Sequence
MHTTLFFSNRTQAVRLPKSISFPEDVKHVEIIAVGRSRIITPVGESWDSWFDGEGASTDFMSTREQPA
Chain C Sequence
MHTTLFFSNRTQAVRLPKSISFPEDVKHVEIIAVGRSRIITPVGESWDSWFDGEGASTDFMSTREQPA
Chain C Sequence
MHTTLFFSNRTQAVRLPKSISFPEDVKHVEIIAVGRSRIITPVGESWDSWFDGEGASTDFMSTREQPA
sequence length 132,68,68,68
structure length 132,68,68,68
publication title Crystal structure of proteolyzed VapBC and DNA-bound VapBC from Salmonella enterica Typhimurium LT2 and VapC as a putative Ca2+-dependent ribonuclease.
pubmed doi rcsb
molecule tags Toxin/antitoxin/dna
molecule keywords tRNA(fMet)-specific endonuclease VapC
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
pdb deposition date2018-09-20
LinkProt deposition date2020-01-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling