| Link type | Probability | Loop ranges | Chain A piercings | Chain C piercings | Chain E piercings | Chain F piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
| view details |
|
Other | 35% | -A | +53A +133C -58F | |||||||||||
Chain A Sequence |
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC |
Chain A Sequence |
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC |
Chain A Sequence |
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC |
Chain A Sequence |
MHTTLFFSNRTQAVRLPKSISFPEDVKHVEIIAVGRSRIITPVGESWDSWFDGEGASTDFMSTREQPA |
| sequence length | 132,132,132,68 |
| structure length | 132,132,132,68 |
| publication title |
Crystal structure of proteolyzed VapBC and DNA-bound VapBC from Salmonella enterica Typhimurium LT2 and VapC as a putative Ca2+-dependent ribonuclease.
pubmed doi rcsb |
| molecule tags | Toxin/antitoxin/dna |
| molecule keywords | tRNA(fMet)-specific endonuclease VapC |
| source organism | Salmonella enterica subsp. enterica serovar typhimurium str. lt2 |
| pdb deposition date | 2018-09-20 |
| LinkProt deposition date | 2020-01-31 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
