6IFMABGH

Crystal structure of dna bound vapbc from salmonella typhimurium
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain G piercings Chain H piercings
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
view details
Other Other 37% -A -43G +58G -25G +42G -69G -69G -67H -133H -2A +68A +132A +68B -30H
Interpreting sequences
Chain A Sequence
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Chain A Sequence
MHTTLFFSNRTQAVRLPKSISFPEDVKHVEIIAVGRSRIITPVGESWDSWFDGEGASTDFMSTREQPA
Chain A Sequence
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Chain A Sequence
MHTTLFFSNRTQAVRLPKSISFPEDVKHVEIIAVGRSRIITPVGESWDSWFDGEGASTDFMSTREQPA
sequence length 132,68,132,68
structure length 132,68,132,68
publication title Crystal structure of proteolyzed VapBC and DNA-bound VapBC from Salmonella enterica Typhimurium LT2 and VapC as a putative Ca2+-dependent ribonuclease.
pubmed doi rcsb
molecule tags Toxin/antitoxin/dna
molecule keywords tRNA(fMet)-specific endonuclease VapC
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
pdb deposition date2018-09-20
LinkProt deposition date2020-01-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling