6IFCABCD

Crystal structure of vapbc from salmonella typhimurium
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
view details
Other Other 32% -A +12C -133C
Interpreting sequences
Chain A Sequence
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Chain A Sequence
SWDSWFDGEGASTDFMSTREQP
Chain A Sequence
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHTGQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Chain A Sequence
ITPVGESWDSWFDGEGASTDFMSTREQP
sequence length 132,22,132,28
structure length 132,22,132,28
publication title Crystal structure of proteolyzed VapBC and DNA-bound VapBC from Salmonella enterica Typhimurium LT2 and VapC as a putative Ca2+-dependent ribonuclease.
pubmed doi rcsb
molecule tags Toxin/antitoxin
molecule keywords tRNA(fMet)-specific endonuclease VapC
source organism Salmonella typhimurium (strain lt2 / sgsc1412 / atcc 700720)
pdb deposition date2018-09-19
LinkProt deposition date2020-01-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling