| Link type | Probability | Loop ranges | Chain B piercings | Chain M piercings | Chain N piercings | Chain Y piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
| view details |
|
Other | 33% | -B | +25B -127B +169B +211B -231B +276B +381B -397B +396M +396M | |||||||||||
Chain B Sequence |
ALLVAKSAKSALQDFNHDYSKSWTFGDKWDNSNTMFETFVNKYLFPKINETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ |
Chain B Sequence |
NETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ |
Chain B Sequence |
ALLVAKSAKSALQDFNHDYSKSWTFGDKWDNSNTMFETFVNKYLFPKINETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ |
Chain B Sequence |
XXXXXXXXXXXXXXXX |
| sequence length | 386,338,386,16 |
| structure length | 386,338,386,16 |
| publication title |
Structure and genome ejection mechanism ofStaphylococcus aureusphage P68.
pubmed doi rcsb |
| molecule tags | Structural protein |
| molecule keywords | Major head protein |
| pdb deposition date | 2018-11-27 |
| LinkProt deposition date | 2019-11-11 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
