6IAWBMNX

Structure of head fiber and inner core protein gp22 of native bacteriophage p68
Link type Probability Loop ranges Chain B piercings Chain M piercings Chain N piercings Chain X piercings
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
view details
Other Other 39% -B -258M -396M -397N -397N -133X +161X -258X +269X +367X +397B +130N +397X -396B -397M -131X
Interpreting sequences
Chain B Sequence
ALLVAKSAKSALQDFNHDYSKSWTFGDKWDNSNTMFETFVNKYLFPKINETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ
Chain B Sequence
NETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ
Chain B Sequence
ALLVAKSAKSALQDFNHDYSKSWTFGDKWDNSNTMFETFVNKYLFPKINETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ
Chain B Sequence
XXXXXXXXXXXXXXXXX
sequence length 386,338,386,17
structure length 386,338,386,17
publication title Structure and genome ejection mechanism ofStaphylococcus aureusphage P68.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Major head protein
pdb deposition date2018-11-27
LinkProt deposition date2019-11-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling