| Link type | Probability | Loop ranges | Chain A piercings | Chain D piercings | Chain Y piercings | Chain Z piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
| view details |
|
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
Chain A Sequence |
QSTKNETALLVAKSAKSALQDFNHDYSKSWTFGDKWDNSNTMFETFVNKYLFPKINETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ |
Chain A Sequence |
ELNENMSIDTNKSEDSYGVQIHSLSKQSFT |
Chain A Sequence |
XXXXXXXXXXXXXXXX |
Chain A Sequence |
XXXXXXXXXXXX |
| sequence length | 393,30,16,12 |
| structure length | 393,30,16,12 |
| publication title |
Structure and genome ejection mechanism ofStaphylococcus aureusphage P68.
pubmed doi rcsb |
| molecule tags | Structural protein |
| molecule keywords | Major head protein |
| pdb deposition date | 2018-11-27 |
| LinkProt deposition date | 2019-11-11 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
