Link type | Probability | Loop ranges | Chain A piercings | Chain D piercings | Chain Y piercings | Chain Z piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z | |||||||||
view details |
![]() |
Other | 35% | -A | -44D -396Y | -119Y -396Z | +123Z |
Chain A Sequence |
QSTKNETALLVAKSAKSALQDFNHDYSKSWTFGDKWDNSNTMFETFVNKYLFPKINETLLIDIALGNRFNWLAKEQDFIGQYSEEYVIMDTVPINMDLSKNEELMLKRNYPRMATKLYGNGIVKKQKFTLNNNDTRFNFQTLADATNYALGVYKKKISDINVLEEKEMRAMLVDYSLNQLSETNVRKATSKEDLASKVFEAILNLQNNSAKYNEVHRASGGAIGQYTTVSKLKDIVILTTDSLKSYLLDTKIANTFQIAGIDFTDHVISFDDLGGVFKVTKEFKLQNQDSIDFLRAYGDYQSQLGDTIPVGAVFTYDVSKLKEFTGNVEEIKPKSDLYAFILDINSIKYKRYTKGMLKPPFHNPEFDEVTHWIHYYSFKAISPFFNKILITDQ |
Chain A Sequence |
ELNENMSIDTNKSEDSYGVQIHSLSKQSFT |
Chain A Sequence |
XXXXXXXXXXXXXXXX |
Chain A Sequence |
XXXXXXXXXXXX |
sequence length | 393,30,16,12 |
structure length | 393,30,16,12 |
publication title |
Structure and genome ejection mechanism ofStaphylococcus aureusphage P68.
pubmed doi rcsb |
molecule tags | Structural protein |
molecule keywords | Major head protein |
pdb deposition date | 2018-11-27 |
LinkProt deposition date | 2019-11-11 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...