| Link type | Probability | Loop ranges | Chain B piercings | Chain F piercings | Chain G piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
| view details |
|
Hopf.2 U Ring | 32% | -B | -255B -278G | ||||||||||
Chain B Sequence |
RKIRNKQSAQDSRRRKKIYVDGLENRVAACTAQNHELQKKVQLLQKQNMSLLEQLRKLQALV |
Chain B Sequence |
TKAEERLLKKVRRKIRNKQSAQDSRRRKKIYVDGLENRVAACTAQNHELQKKVQLLQKQNMSLLEQLRKLQ |
Chain B Sequence |
IRNKQSAQDSRRRKKIYVDGLENRVAACTAQNHELQK |
| sequence length | 62,71,37 |
| structure length | 62,71,37 |
| publication title |
The crystal structure of the chicken CREB3 bZIP
rcsb |
| molecule tags | Transcription |
| molecule keywords | Uncharacterized protein |
| source organism | Gallus gallus |
| pdb deposition date | 2018-11-26 |
| LinkProt deposition date | 2019-12-14 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
