| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
| view details |
|
Hopf.2 U Ring | 49% | -A | -11B +159B | -159A -131B | |||||||||
Chain A Sequence |
HHHHSSGVDLGTENLYFQSLQNIFYDFDKATLRPESMKSLDELIRILTDNPDIRIELGSHADRKGPDAYNLGLSDRRAKSVVDYLTSRGIAADRLTWKGYGKSVPKTVTAKIAERHDFLKEGDVLTEEFVAPLTEEQQSVCDQLNRRTEFRVIE |
Chain A Sequence |
SSGVDLGTENLYFQSLQNIFYDFDKATLRPESMKSLDELIRILTDNPDIRIELGSHADRKGPDAYNLGLSDRRAKSVVDYLTSRGIAADRLTWKGYGKSVPKTVTAKIAERHDFLKEGDVLTEEFVAPLTEEQQSVCDQLNRRTEFRVIE |
Chain A Sequence |
SSGVDLGTENLYFQSLQNIFYDFDKATLRPESMKSLDELIRILTDNPDIRIELGSHADRKGPDAYNLGLSDRRAKSVVDYLTSRGIAADRLTWKGYGKSVPKTVTAKIAERHDFLKEGDVLTEEFVAPLTEEQQSVCDQLNRRTEFRVIE |
| sequence length | 154,150,150 |
| structure length | 154,150,150 |
| publication title |
Structure of a PG1058 domain, a protein of T9SS from Porphyromonas gingivalis
rcsb |
| molecule tags | Protein binding |
| molecule keywords | OmpA family protein |
| source organism | Porphyromonas gingivalis |
| pdb deposition date | 2018-11-24 |
| LinkProt deposition date | 2019-12-08 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
