6HWNDEFN

Structure of thermus thermophilus clpp in complex with a tripeptide.
D: 7-15 E: 8-15 F: 8-14
Link type Probability Loop ranges Chain D piercings Chain E piercings Chain F piercings Chain N piercings
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
view details
Other Other 30% -D -195E -195E -195E -42F -77F -104F -3F -196N
Interpreting sequences
Chain D Sequence
VIPYVI-------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEAL
Chain D Sequence
IPYVIE------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEA
Chain D Sequence
VIPYVIE-----ERVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREE
Chain D Sequence
XXX
sequence length 194,192,192,3
structure length 187,186,187,3
publication title Mechanism of the allosteric activation of the ClpP protease machinery by substrates and active-site inhibitors
doi rcsb
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
source organism Thermus thermophilus
missing residues D: 7-15 E: 8-15 F: 8-14
pdb deposition date2018-10-12
LinkProt deposition date2019-09-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling