| Link type | Probability | Loop ranges | Chain B piercings | Chain G piercings | Chain J piercings | Chain L piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
| view details |
|
Other | 35% | -B | +135B -194B | |||||||||||
Chain B Sequence |
VIPYVIE------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREE |
Chain B Sequence |
VIPYVIE--------YDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREE |
Chain B Sequence |
XXX |
Chain B Sequence |
XXX |
| sequence length | 192,192,3,3 |
| structure length | 186,184,3,3 |
| publication title |
Mechanism of the allosteric activation of the ClpP protease machinery by substrates and active-site inhibitors
doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | ATP-dependent Clp protease proteolytic subunit |
| source organism | Thermus thermophilus |
| missing residues | B: 8-15 G: 8-17 |
| pdb deposition date | 2018-10-12 |
| LinkProt deposition date | 2019-09-21 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
