6HWNADIK

Structure of thermus thermophilus clpp in complex with a tripeptide.
A: 7-15 D: 7-15
Link type Probability Loop ranges Chain A piercings Chain D piercings Chain I piercings Chain K piercings
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
view details
Other Other 34% -A -3K -196A +129K -196K
Interpreting sequences
Chain A Sequence
VIPYVI-------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEAL
Chain A Sequence
VIPYVI-------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEAL
Chain A Sequence
XXX
Chain A Sequence
XXX
sequence length 194,194,3,3
structure length 187,187,3,3
publication title Mechanism of the allosteric activation of the ClpP protease machinery by substrates and active-site inhibitors
doi rcsb
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
source organism Thermus thermophilus
missing residues A: 7-15 D: 7-15
pdb deposition date2018-10-12
LinkProt deposition date2019-09-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling