6HWNACEK

Structure of thermus thermophilus clpp in complex with a tripeptide.
A: 7-15 C: 9-14 E: 8-15
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain E piercings Chain K piercings
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
view details
Other Other 36% -A -194K -194K -195K -195K -62A -90A -112A -187A +62K -196K
Interpreting sequences
Chain A Sequence
VIPYVI-------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEAL
Chain A Sequence
VIPYVIEQ----ERVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREE
Chain A Sequence
IPYVIE------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEA
Chain A Sequence
XXX
sequence length 194,192,192,3
structure length 187,188,186,3
publication title Mechanism of the allosteric activation of the ClpP protease machinery by substrates and active-site inhibitors
doi rcsb
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
source organism Thermus thermophilus
missing residues A: 7-15 C: 9-14 E: 8-15
pdb deposition date2018-10-12
LinkProt deposition date2019-09-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling