6HWMABCD

Structure of thermus thermophilus clpp in complex with bortezomib
A: 9-16 B: 7-15 C: 7-17 D: 8-17
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
view details
Other Other 35% -A -202B -202B -202B +31C -41C -75C -101C -174C -194C -193D
Interpreting sequences
Chain A Sequence
IPYVIEQ------VYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREE
Chain A Sequence
IPYVI-------RVYDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREEALEHHHHH
Chain A Sequence
VIPYVI---------YDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREE
Chain A Sequence
VIPYVIE--------YDIYSRLLKDRIIFLGTPIDAQVANVVVAQLLFLDAQNPNQEIKLYINSPGGEVDAGLAIYDTMQFVRAPVSTIVIGMAASMAAVILAAGEKGRRYALPHAKVMIHQPWGGVRGTASDIAIQAQEILKAKKLLNEILAKHTGQPLEKVEKDTDRDYYLSAQEALEYGLIDQVVTREE
sequence length 191,199,192,192
structure length 185,192,183,184
publication title Mechanism of the allosteric activation of the ClpP protease machinery by substrates and active-site inhibitors
doi rcsb
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
source organism Thermus thermophilus
missing residues A: 9-16 B: 7-15 C: 7-17 D: 8-17
pdb deposition date2018-10-12
LinkProt deposition date2019-09-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling