| Link type | Probability | Loop ranges | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
| view details |
|
Hopf.2 | 49% | -B | -138D | -66B | ||||||||
Chain B Sequence |
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKVLLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV |
Chain B Sequence |
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKVLLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV |
| sequence length | 138,138 |
| structure length | 138,138 |
| publication title |
The E. coli HicB Antitoxin Contains a Structurally Stable Helix-Turn-Helix DNA Binding Domain.
pubmed doi rcsb |
| molecule tags | Toxin |
| molecule keywords | mRNA interferase toxin HicA |
| source organism | Escherichia coli str. k-12 substr. mg1655 |
| pdb deposition date | 2018-09-20 |
| LinkProt deposition date | 2019-09-21 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
