6HNNABCD

Crystal structure of wild-type idmh, a putative polyketide cyclase from streptomyces antibioticus
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
view details
Other Other 42% -A -144D -147A +145C +13D +120D -147D
Interpreting sequences
Chain A Sequence
HQPSDTIAGLYEAFNSGDLETLRELIAPDAVIHLPGTAGDAEHPPGTPRDREGWLGVWQFTQAFFPDMTATVQDIVQTGDLVATRCVARGTHSIEFMGVPPTGRPFEMTMLNMSRVRDGRIVEHWTISDNVTMLAQLGVKA
Chain A Sequence
HQPSDTIAGLYEAFNSGDLETLRELIAPDAVIHLPGTAGDAEHPPGTPRDREGWLGVWQFTQAFFPDMTATVQDIVQTGDLVATRCVARGTHSIEFMGVPPTGRPFEMTMLNMSRVRDGRIVEHWTISDNVTMLAQLG
Chain A Sequence
HQPSDTIAGLYEAFNSGDLETLRELIAPDAVIHLPGTAGDAEHPPGTPRDREGWLGVWQFTQAFFPDMTATVQDIVQTGDLVATRCVARGTHSIEFMGVPPTGRPFEMTMLNMSRVRDGRIVEHWTISDNVTMLAQLG
Chain A Sequence
HQPSDTIAGLYEAFNSGDLETLRELIAPDAVIHLPGTAGDAEHPPGTPRDREGWLGVWQFTQAFFPDMTATVQDIVQTGDLVATRCVARGTHSIEFMGVPPTGRPFEMTMLNMSRVRDGRIVEHWTISDNVTMLAQLGV
sequence length 141,138,138,139
structure length 141,138,138,139
publication title Crystal structure of the putative cyclase IdmH from the indanomycin nonribosomal peptide synthase/polyketide synthase
doi rcsb
molecule tags Biosynthetic protein
molecule keywords Putative polyketide cyclase IdmH
source organism Streptomyces antibioticus
pdb deposition date2018-09-16
LinkProt deposition date2019-11-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling