6HJMABGH

Myxococcus xanthus mglb
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain G piercings Chain H piercings
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
view details
Other Other 31% -A +6H -134H
Interpreting sequences
Chain A Sequence
VMYEEEFTKINAVCDRLTKDANAKVVFLVDKNGQLISSAGQTQNIDTTSLASLTAGNVAAMGGLAKLIGENEFPNQFHEGAKDSLYMTIVGSRVVLVVIFDNRTSLGLVRLRIKKASDELTKIFESLV
Chain A Sequence
YEEEFTKINAVCDRLTKDANAKVVFLVDKNGQLISSAGQTQNIDTTSLASLTAGNVAAMGGLAKLIGENEFPNQFHEGAKDSLYMTIVGSRVVLVVIFDNRTSLGLVRLRIKKASDELTKIFESLV
Chain A Sequence
VMYEEEFTKINAVCDRLTKDANAKVVFLVDKNGQLISSAGQTQNIDTTSLASLTAGNVAAMGGLAKLIGENEFPNQFHEGAKDSLYMTIVGSRVVLVVIFDNRTSLGLVRLRIKKASDELTKIFES
Chain A Sequence
EFTKINAVCDRLTKDANAKVVFLVDKNGQLISSAGQTQNIDTTSLASLTAGNVAAMGGLAKLIGENEFPNQFHEGAKDSLYMTIVGSRVVLVVIFDNRTSLGLVRLRIKKASDELTKIFES
sequence length 128,126,126,121
structure length 128,126,126,121
publication title MglA functions as a three-state GTPase to control movement reversals of Myxococcus xanthus.
pubmed doi rcsb
molecule tags Cytosolic protein
molecule keywords MglB
source organism Myxococcus xanthus
pdb deposition date2018-09-04
LinkProt deposition date2019-12-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling