6HGOABCD

Crystal structure of human il-17f
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
view details
Other Other 53% -A -60B -71C -161D -161A +161A +72B -85B +99B
Interpreting sequences
Chain A Sequence
HTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Chain A Sequence
GHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPV
Chain A Sequence
PKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIH
Chain A Sequence
HTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPV
sequence length 126,122,127,121
structure length 126,122,127,121
publication title Structural and biochemical studies of cytokine recognition by human IL-17RC: implications for IL-17 signaling
rcsb
molecule tags Immune system
molecule keywords Interleukin-17F
source organism Homo sapiens
pdb deposition date2018-08-23
LinkProt deposition date2019-11-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling