6H4CCDFH

A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature.
Link type Probability Loop ranges Chain C piercings Chain D piercings Chain F piercings Chain H piercings
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
view details
Other Other 31% -C -155D -31F +132F -154F -61C +137C -8D +55D
Interpreting sequences
Chain C Sequence
TNTLQVRLLSENARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDAIASNGYITPGVFDIKGEIDLSDAIRQYGTYQINEGDKLAQLVIVPIWTPELKQVEEFE
Chain C Sequence
MAELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEIYGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYDETIKLLELLKESKINVNDIDYDYVLKLYKQILST
Chain C Sequence
LPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEIYGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYDETIKLLELLKESKINVNDIDYDYVLKLYKQILS
Chain C Sequence
ELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEIYGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYDETIKLLELLKESKINVNDIDYDYVLKLYKQILS
sequence length 153,148,144,145
structure length 153,148,144,145
publication title The structure of a polygamous repressor reveals how phage-inducible chromosomal islands spread in nature.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords dUTPase
source organism Staphylococcus phage phi11
pdb deposition date2018-07-20
LinkProt deposition date2019-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling