6H4CACEG

A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature.
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain E piercings Chain G piercings
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
view details
Other Other 31% -A +11E -30E +155G +7A +6C -140C
Interpreting sequences
Chain A Sequence
TNTLQVRLLSENARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDAIASNGYITPGVFDIKGEIDLSDAIRQYGTYQINEGDKLAQLVIVPIWTPELKQVEEFE
Chain A Sequence
TNTLQVRLLSENARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDAIASNGYITPGVFDIKGEIDLSDAIRQYGTYQINEGDKLAQLVIVPIWTPELKQVEEFE
Chain A Sequence
MTNTLQVRLLSENARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDAIASNGYITPGVFDIKGEIDLSDAIRQYGTYQINEGDKLAQLVIVPIWTPELKQVEEFE
Chain A Sequence
TNTLQVRLLSENARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDAIASNGYITPGVFDIKGEIDLSDAIRQYGTYQINEGDKLAQLVIVPIWTPELKQVEEFESV
sequence length 153,153,154,155
structure length 153,153,154,155
publication title The structure of a polygamous repressor reveals how phage-inducible chromosomal islands spread in nature.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords dUTPase
source organism Staphylococcus phage phi11
pdb deposition date2018-07-20
LinkProt deposition date2019-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling