6GXSABCD

Crystal structure of cv39l lectin from chromobacterium violaceum at 1.8 a resolution
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
view details
Other Other 37% -A -374D -375D -375D -375D -333A -354A -370A -375A +375A +156B
Interpreting sequences
Chain A Sequence
SSSQFHGLAIGNGNSNYLQVLGLANITDTAYLTDWQDSGGNWHAGFALPVPSDYPKGHFFQLTTGVGNSNYLQVLGAGEDGNPYLVSWQDGSGKWHGGMPLPKPSGYSGGPLVTGIGNSNYLQVIGARVESSPYLVAWQDNGGNWHAGMPLPNPSGYAGGFQQLATGNGNDHFLQVVGVGNDGNAYLVTWQNAQGQWSPGFALPKPSGYSGTFTQLATGVGNGNFLQVLGIGTDGNAYLVAWQDNGGNWHPGFALPKPSGYNGTFAKLVTGIGNSNYLQVFGIGSNGVAYLVSWQDSGGNWHGGLTLPQPSGYNGSFSQLAAGNGNSHYLQVVGTDAQGNVYLVSWQDSEGKWHAGFELPRA
Chain A Sequence
SSSQFHGLAIGNGNSNYLQVLGLANITDTAYLTDWQDSGGNWHAGFALPVPSDYPKGHFFQLTTGVGNSNYLQVLGAGEDGNPYLVSWQDGSGKWHGGMPLPKPSGYSGGPLVTGIGNSNYLQVIGARVESSPYLVAWQDNGGNWHAGMPLPNPSGYAGGFQQLATGNGNDHFLQVVGVGNDGNAYLVTWQNAQGQWSPGFALPKPSGYSGTFTQLATGVGNGNFLQVLGIGTDGNAYLVAWQDNGGNWHPGFALPKPSGYNGTFAKLVTGIGNSNYLQVFGIGSNGVAYLVSWQDSGGNWHGGLTLPQPSGYNGSFSQLAAGNGNSHYLQVVGTDAQGNVYLVSWQDSEGKWHAGFELPRAS
Chain A Sequence
SSQFHGLAIGNGNSNYLQVLGLANITDTAYLTDWQDSGGNWHAGFALPVPSDYPKGHFFQLTTGVGNSNYLQVLGAGEDGNPYLVSWQDGSGKWHGGMPLPKPSGYSGGPLVTGIGNSNYLQVIGARVESSPYLVAWQDNGGNWHAGMPLPNPSGYAGGFQQLATGNGNDHFLQVVGVGNDGNAYLVTWQNAQGQWSPGFALPKPSGYSGTFTQLATGVGNGNFLQVLGIGTDGNAYLVAWQDNGGNWHPGFALPKPSGYNGTFAKLVTGIGNSNYLQVFGIGSNGVAYLVSWQDSGGNWHGGLTLPQPSGYNGSFSQLAAGNGNSHYLQVVGTDAQGNVYLVSWQDSEGKWHAGFELPRA
Chain A Sequence
SSQFHGLAIGNGNSNYLQVLGLANITDTAYLTDWQDSGGNWHAGFALPVPSDYPKGHFFQLTTGVGNSNYLQVLGAGEDGNPYLVSWQDGSGKWHGGMPLPKPSGYSGGPLVTGIGNSNYLQVIGARVESSPYLVAWQDNGGNWHAGMPLPNPSGYAGGFQQLATGNGNDHFLQVVGVGNDGNAYLVTWQNAQGQWSPGFALPKPSGYSGTFTQLATGVGNGNFLQVLGIGTDGNAYLVAWQDNGGNWHPGFALPKPSGYNGTFAKLVTGIGNSNYLQVFGIGSNGVAYLVSWQDSGGNWHGGLTLPQPSGYNGSFSQLAAGNGNSHYLQVVGTDAQGNVYLVSWQDSEGKWHAGFELPRAS
sequence length 362,363,361,362
structure length 362,363,361,362
publication title Characterization of novel lectins from Burkholderia pseudomallei and Chromobacterium violaceum with seven-bladed beta-propeller fold
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords CV39L lectin
source organism Chromobacterium violaceum (strain atcc 12472 / dsm 30191 / jcm 1249 / nbrc 12614
pdb deposition date2018-06-27
LinkProt deposition date2019-12-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling