| Link type | Probability | Loop ranges | Chain A piercings | Chain P piercings | Chain Q piercings | Chain S piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
| view details |
|
Other | 37% | -A | -100P -183Q -514S -514S -514S | -7A -11A -230A | ||||||||||
Chain A Sequence |
SHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE-AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTL----YKDSTLIMQLLRDNLTLWTS |
Chain A Sequence |
KLLQ |
Chain A Sequence |
RSLAPG |
Chain A Sequence |
RSLAPG |
| sequence length | 232,5,7,7 |
| structure length | 227,4,6,6 |
| publication title |
14-3-3 with peptide
rcsb |
| molecule tags | Signaling protein |
| molecule keywords | 14-3-3 protein zeta/delta |
| source organism | Homo sapiens |
| missing residues | A: 70-72,206-211 |
| pdb deposition date | 2018-08-16 |
| LinkProt deposition date | 2019-11-02 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
