6EF5ADPS

14-3-3 with peptide
A: 70-72,206-211
Link type Probability Loop ranges Chain A piercings Chain D piercings Chain P piercings Chain S piercings
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
view details
Other Other 47% -A +96D +231P -100A +124A -515P -515P -31S -231S -103A -106D
Interpreting sequences
Chain A Sequence
SHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE-AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTL----YKDSTLIMQLLRDNLTLWTS
Chain A Sequence
SHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS
Chain A Sequence
KLLQ
Chain A Sequence
RSLAPG
sequence length 232,232,5,7
structure length 227,232,4,6
publication title 14-3-3 with peptide
rcsb
molecule tags Signaling protein
molecule keywords 14-3-3 protein zeta/delta
source organism Homo sapiens
missing residues A: 70-72,206-211
pdb deposition date2018-08-16
LinkProt deposition date2019-11-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling