Link type | Probability | Loop ranges | Chain A piercings | Chain D piercings | Chain P piercings | Chain S piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D | |||||||||
view details |
![]() |
Other | 47% | -A | +96D +231P | -100A +124A -515P -515P -31S -231S | -103A -106D |
Chain A Sequence |
SHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE-AEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTL----YKDSTLIMQLLRDNLTLWTS |
Chain A Sequence |
SHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS |
Chain A Sequence |
KLLQ |
Chain A Sequence |
RSLAPG |
sequence length | 232,232,5,7 |
structure length | 227,232,4,6 |
publication title |
14-3-3 with peptide
rcsb |
molecule tags | Signaling protein |
molecule keywords | 14-3-3 protein zeta/delta |
source organism | Homo sapiens |
missing residues | A: 70-72,206-211 |
pdb deposition date | 2018-08-16 |
LinkProt deposition date | 2019-11-02 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...