6EB8BGH

Crystal structure of the nipah virus phosphoprotein multimerization domain g519n
Link type Probability Loop ranges Chain B piercings Chain G piercings Chain H piercings
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
view details
Hopf.2 U Ring Hopf.2 U Ring 51% -B -576B -539H +505B -517B -563G +576G
Interpreting sequences
Chain B Sequence
KYIMPSDDFSNTFFPHDTDRLNYHADHLGDYDLETLCEESVLMNVINSIKLINLDMRLNHIEEQVKEIPKIINKLESIDRVLAKTNTALSTIEGHLVSMM
Chain B Sequence
KYIMPSDDFSNTFFPHDTDRLNYHADHLGDYDLETLCEESVLMNVINSIKLINLDMRLNHIEEQVKEIPKIINKLESIDRVLAKTNTALSTIEGHLVSMMI
Chain B Sequence
KYIMPSDDFSNTFFPHDTDRLNYHADHLGDYDLETLCEESVLMNVINSIKLINLDMRLNHIEEQVKEIPKIINKLESIDRVLAKTNTALSTIEGHLVSMMI
sequence length 100,101,101
structure length 100,101,101
publication title A Conserved Basic Patch and Central Kink in the Nipah Virus Phosphoprotein Multimerization Domain Are Essential for Polymerase Function.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords Phosphoprotein
source organism Nipah virus
pdb deposition date2018-08-06
LinkProt deposition date2019-03-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling