6E6JBCDE

Brd2_bromodomain2 complex with inhibitor 744
Link type Probability Loop ranges Chain B piercings Chain C piercings Chain D piercings Chain E piercings
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
view details
Other Other 34% -B -385C -434C -454D -455D +359E +454E
Interpreting sequences
Chain B Sequence
HMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMP
Chain B Sequence
HMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMP
Chain B Sequence
HMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMP
Chain B Sequence
HMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMP
sequence length 109,109,109,109
structure length 109,109,109,109
publication title Selective Inhibition of the Second Bromodomain of BET Family Maintains Anti-Tumor Efficacy and Improves Tolerability
rcsb
molecule tags Signaling protein
molecule keywords Bromodomain-containing protein 2
source organism Homo sapiens
pdb deposition date2018-07-25
LinkProt deposition date2019-08-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling