| Link type | Probability | Loop ranges | Chain A piercings | Chain C piercings | Chain E piercings | Chain G piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
| view details |
|
Other | 39% | -A | -70E -63G | -47A -70A -69C -70C -47G | ||||||||||
Chain A Sequence |
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFG |
Chain A Sequence |
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFG |
Chain A Sequence |
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFG |
Chain A Sequence |
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFG |
| sequence length | 69,69,69,69 |
| structure length | 69,69,69,69 |
| publication title |
Cryo-EM structure of an amyloid fibril from systemic amyloidosis
doi rcsb |
| molecule tags | Protein fibril |
| molecule keywords | Serum amyloid A-2 protein |
| pdb deposition date | 2018-06-14 |
| LinkProt deposition date | 2019-03-16 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
