6DIIABCD

Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
view details
Other Other 50% -A +72B -400B -431B +447B +490B +537B -36C +54C +606C +606C +605D +605D -24A +59A +480A +606A +32D -58D -605A -605A -605A -465B -517B -605B -605D
Interpreting sequences
Chain A Sequence
YQVMKRASEVDLSTVKYKAETMKAPHLTGLSFKLFVNLLEAPLIGSLIVDYLKKDNGMTKIFRNTVIPEEPMFRPEFPSQEPEHDVVIVGEDESPIDRLETALKCLPQYDPSRSLHADPVSSFRYWKIRDYAYAYRSKLTTPLQVAKRIISIIEEFGYDKPPTPFLIRFDANEVIKQAEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSADRYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGCKVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSKLSYDTRTSFAIFRSFSASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRFVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELAPVTKKPAIFYDILN
Chain A Sequence
MGKYQVMKRASEVDLSTVKYKAETMKAPHLTGLSFKLFVNLLEAPLIGSLIVDYLKKDNGMTKIFRNTVIPEEPMFRPEFPSQEPEHDVVIVGEDESPIDRLETALKCLPQYDPSRSLHADPVSSFRYWKIRDYAYAYRSKLTTPLQVAKRIISIIEEFGYDKPPTPFLIRFDANEVIKQAEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSADRYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGCKVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSKLSYDTRTSFAIFRSFSASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRFVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELAPVTKKPAIFYDILN
Chain A Sequence
YQVMKRASEVDLSTVKYKAETMKAPHLTGLSFKLFVNLLEAPLIGSLIVDYLKKDNGMTKIFRNTVIPEEPMFRPEFPSQEPEHDVVIVGEDESPIDRLETALKCLPQYDPSRSLHADPVSSFRYWKIRDYAYAYRSKLTTPLQVAKRIISIIEEFGYDKPPTPFLIRFDANEVIKQAEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSADRYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGCKVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSKLSYDTRTSFAIFRSFSASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRFVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELAPVTKKPAIFYDILN
Chain A Sequence
MGKYQVMKRASEVDLSTVKYKAETMKAPHLTGLSFKLFVNLLEAPLIGSLIVDYLKKDNGMTKIFRNTVIPEEPMFRPEFPSQEPEHDVVIVGEDESPIDRLETALKCLPQYDPSRSLHADPVSSFRYWKIRDYAYAYRSKLTTPLQVAKRIISIIEEFGYDKPPTPFLIRFDANEVIKQAEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSADRYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGCKVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSKLSYDTRTSFAIFRSFSASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRFVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELAPVTKKPAIFYDILN
sequence length 602,605,602,605
structure length 602,605,602,605
publication title Structural analysis of a plant fatty acid amide hydrolase provides insights into the evolutionary diversity of bioactive acylethanolamides
rcsb
molecule tags Hydrolase
molecule keywords Fatty acid amide hydrolase
source organism Arabidopsis thaliana
pdb deposition date2018-05-23
LinkProt deposition date2019-03-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling