6DCAKLOR

Fab/epitope complex of mouse monoclonal antibody 6b2 targeting a non-phosphorylated tau epitope.
K: 128-133 L: 198-202 O: 198-202
Link type Probability Loop ranges Chain K piercings Chain L piercings Chain O piercings Chain R piercings
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
view details
Other Other 44% -K +154L -198L
Interpreting sequences
Chain K Sequence
VQLQQSGPELVKPGASVKISCKTSEYTFTEYTKHWVKQSHGKSLEWIGSINPNNGDTYYNQKFTDKATLTVDKSSTTASMELRSLTFEDSAVYYCAMGDSAWFAYWGQGTLVTVSSAKTTPPSVYPL----APGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Chain K Sequence
DVQMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTHSPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYT---CEATHTSPIVKSFNRNE
Chain K Sequence
DVQMTQTPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCVQGTHSPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYT---CEATHTSPIVKSFNRNE
Chain K Sequence
TSPRHL
sequence length 217,218,218,6
structure length 213,215,215,6
publication title Structural characterization of monoclonal antibodies targeting C-terminal Ser404region of phosphorylated tau protein.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab light chain
missing residues K: 128-133 L: 198-202 O: 198-202
pdb deposition date2018-05-04
LinkProt deposition date2019-03-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling