| Link type | Probability | Loop ranges | Chain E piercings | Chain F piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
| view details |
|
Hopf.2 | 67% | -E | +286F -301F -312F +368F -381F | -46E | ||||||||
Chain E Sequence |
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQ |
Chain E Sequence |
SKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLC---------ICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLH |
| sequence length | 73,360 |
| structure length | 73,351 |
| publication title |
Near-atomic structure of a novel site II/IV antigenic epitope on respiratory syncytial virus fusion glycoprotein determined by cryo-EM
rcsb |
| molecule tags | Viral protein/immune system |
| molecule keywords | R4.C6 Fab Heavy Chain |
| source organism | Mus musculus |
| missing residues | F: 322-332 |
| pdb deposition date | 2018-04-02 |
| LinkProt deposition date | 2019-08-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
