6CXCDFJ

3.9a cryo-em structure of murine antibody bound at a novel epitope of respiratory syncytial virus fusion protein
D: 322-332 F: 322-332
Link type Probability Loop ranges Chain D piercings Chain F piercings Chain J piercings
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
view details
Hopf.2 U Ring Hopf.2 U Ring 47% -D -192F +175J -251J +284J -302J -514J
Interpreting sequences
Chain D Sequence
VSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLC---------ICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLH
Chain D Sequence
SKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLC---------ICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLH
Chain D Sequence
DILLTQSQKFMSTSVGDRVSITCKASQNVRTGVSWYQRKPGQSPKALIYLASNRHTGVPDRFTGRGSGTDFTLTISEVQSEDLADYFCLQHWTVPYTFGGGTKLEIKR
sequence length 361,360,108
structure length 352,351,108
publication title Near-atomic structure of a novel site II/IV antigenic epitope on respiratory syncytial virus fusion glycoprotein determined by cryo-EM
rcsb
molecule tags Viral protein/immune system
molecule keywords R4.C6 Fab Heavy Chain
source organism Mus musculus
missing residues D: 322-332 F: 322-332
pdb deposition date2018-04-02
LinkProt deposition date2019-08-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling