6CXCBEI

3.9a cryo-em structure of murine antibody bound at a novel epitope of respiratory syncytial virus fusion protein
B: 322-333
Link type Probability Loop ranges Chain B piercings Chain E piercings Chain I piercings
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
view details
Hopf.1 U Ring Hopf.1 U Ring 42% -B +53E -98E +230I -248I -291I +514I +115B +515I
Interpreting sequences
Chain B Sequence
AIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLC----------CLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLH
Chain B Sequence
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQ
Chain B Sequence
QLQQSGPELVKPGASVKISCKASGYAFSNSWMSWVKQRPGKGLEWIGRLFPADGDITYNGHFKDKAALTADKSSNTAYIQLSSLTSEDSAVYFCARMDNSEVFWGQGTLVTVSA
sequence length 368,73,114
structure length 358,73,114
publication title Near-atomic structure of a novel site II/IV antigenic epitope on respiratory syncytial virus fusion glycoprotein determined by cryo-EM
rcsb
molecule tags Viral protein/immune system
molecule keywords R4.C6 Fab Heavy Chain
source organism Mus musculus
missing residues B: 322-333
pdb deposition date2018-04-02
LinkProt deposition date2019-08-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling