| Link type | Probability | Loop ranges | Chain A piercings | Chain C piercings | Chain I piercings | Chain K piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
| view details |
|
Other | 30% | -A | -53I +98I | |||||||||||
Chain A Sequence |
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQ |
Chain A Sequence |
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLM |
Chain A Sequence |
QLQQSGPELVKPGASVKISCKASGYAFSNSWMSWVKQRPGKGLEWIGRLFPADGDITYNGHFKDKAALTADKSSNTAYIQLSSLTSEDSAVYFCARMDNSEVFWGQGTLVTVSA |
Chain A Sequence |
DILLTQSQKFMSTSVGDRVSITCKASQNVRTGVSWYQRKPGQSPKALIYLASNRHTGVPDRFTGRGSGTDFTLTISEVQSEDLADYFCLQHWTVPYTFGGGTKLEIKR |
| sequence length | 73,72,114,108 |
| structure length | 73,72,114,108 |
| publication title |
Near-atomic structure of a novel site II/IV antigenic epitope on respiratory syncytial virus fusion glycoprotein determined by cryo-EM
rcsb |
| molecule tags | Viral protein/immune system |
| molecule keywords | R4.C6 Fab Heavy Chain |
| source organism | Mus musculus |
| pdb deposition date | 2018-04-02 |
| LinkProt deposition date | 2019-08-03 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
