6CXCACEI

3.9a cryo-em structure of murine antibody bound at a novel epitope of respiratory syncytial virus fusion protein
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain E piercings Chain I piercings
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
view details
Other Other 39% -A +98C +98E +98I +92A -50A -53C -114I
Interpreting sequences
Chain A Sequence
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQ
Chain A Sequence
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLM
Chain A Sequence
QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQ
Chain A Sequence
QLQQSGPELVKPGASVKISCKASGYAFSNSWMSWVKQRPGKGLEWIGRLFPADGDITYNGHFKDKAALTADKSSNTAYIQLSSLTSEDSAVYFCARMDNSEVFWGQGTLVTVSA
sequence length 73,72,73,114
structure length 73,72,73,114
publication title Near-atomic structure of a novel site II/IV antigenic epitope on respiratory syncytial virus fusion glycoprotein determined by cryo-EM
rcsb
molecule tags Viral protein/immune system
molecule keywords R4.C6 Fab Heavy Chain
source organism Mus musculus
pdb deposition date2018-04-02
LinkProt deposition date2019-08-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling