6CV1ABCD

Cryoem structure of human enterovirus d68 full particle (after incubation with heparin-derived hexasaccharide)
A: 128-134
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
view details
Other Other 44% -A -98B +111B -135B -168B +189B -220B -62C -294C +59C +280D
Interpreting sequences
Chain A Sequence
IESIIKTATDTVKSEINAELGVVPSLNAVETGATSNTEPEEAIQTRTVINQHGVSETLVENFLSRAALVSKRSFEYKDHTSSAAQTDKNFFKWTINTRSFVQLRRKLELFTYLRFDAEITILTTVAVN-----TYMGLPNLTLQAMFVPTGALTPEKQDSFHWQSGSNASVFFKISDPPARMTIPFMCINSAYSVFYDGFAGFEKSGLYGINPADTIGNLCVRIVNEHQPVGFTVTVRVYMKPKHIKAWAPRPPRTLPYMSIANANYKGKKRAPNALNAIIGNRDSVKTMPHNIV
Chain A Sequence
GVPTYLLPGSGQFLTTDDHSSAPVLPCFNPTPEMHIPGQVRNMLEVVQVESMMEINNTESAVGMERLKVDISALTDVDQLLFNIPLDIQLDGPLRNTLVGNISRYYTHWSGSLEMTFMFCGSFMATGKLILCYTPPGGSCPTTRETAMLGTHIVWDFGLQSSVTLIIPWISGSHYRMFNNDAKSTNANVGYVTCFMQTNLIVPSESSDTCSLIGFIAAKDDFSLRLMRDSPDIGQIDHLHAAEAAYQ
Chain A Sequence
SDRVLQLKLGNSAIVTQEAANYCCAYGEWPNYLPDHEAVAIDKPTQPETATDRFYTLKSVKWEAGSTGWWWKLPDALNNIGMFGQNVQHHYLYRSGFLIHVQCNATRFHQGALLVVAIPEHQRGAHNTNTSPGFDDIMKGEEGGTFNHPYVLDDGTSLACATIFPHQWINLRTNNSATIVLPWMNAAPMDFPLRHNQWTLAIIPVVPLGTRTMSSMVPITVSIAPMCCEFNGLRHAI
Chain A Sequence
NFYKDSYAASASKQDFSQDPSKFTEPVVE
sequence length 295,247,237,29
structure length 290,247,237,29
publication title Bypassing pan-enterovirus host factor PLA2G16
doi rcsb
molecule tags Virus
molecule keywords viral protein 1
missing residues A: 128-134
pdb deposition date2018-03-27
LinkProt deposition date2019-07-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling