6CSUABCD

The structure of the cep63-cep152 heterotetrameric complex
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
view details
Other Other 54% -A -1256B -498C +540D +531A +1229C +531D
Interpreting sequences
Chain A Sequence
ACLNTRFLEEEELRSHHILERLDAHIEELKRES
Chain A Sequence
GALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKM
Chain A Sequence
ACLNTRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTAL
Chain A Sequence
MGALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKM
sequence length 33,51,43,52
structure length 33,51,43,52
publication title Molecular architecture of a cylindrical self-assembly at human centrosomes.
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords Centrosomal protein of 152 kDa
source organism Homo sapiens
pdb deposition date2018-03-21
LinkProt deposition date2019-03-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling