| Link type | Probability | Loop ranges | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
| view details |
|
Hopf.2 | 65% | -A | -21B | -92A -113A +128A | ||||||||
Chain A Sequence |
DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLRVGNIMAVMATAMYLQMEHVVDTCRKFIKAS |
Chain A Sequence |
DSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLRVGNIMAVMATAMYLQMEHVVDTCRKFIKAS |
| sequence length | 123,123 |
| structure length | 123,123 |
| publication title |
Structure of BCL6 BTB in complex with 15a
rcsb |
| molecule tags | Protein binding/inhibitor |
| molecule keywords | B-cell lymphoma 6 protein |
| source organism | Homo sapiens |
| pdb deposition date | 2018-03-14 |
| LinkProt deposition date | 2019-03-27 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
