6AJ4ABCG

Crystal structure of the dhr-2 domain of dock7 in complex with cdc42
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain G piercings
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
view details
Other Other 30% -A -2080G -2080A +1945C +2079G -2080A -2080A -106B -133B
Interpreting sequences
Chain A Sequence
ERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN
Chain A Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALE
Chain A Sequence
ERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN
Chain A Sequence
ERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLIN
sequence length 275,178,275,275
structure length 275,178,275,275
publication title Structural Basis for the Dual Substrate Specificity of DOCK7 Guanine Nucleotide Exchange Factor.
doi rcsb
molecule tags Signaling protein
molecule keywords Dedicator of cytokinesis protein 7
source organism Homo sapiens
pdb deposition date2018-08-27
LinkProt deposition date2019-03-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling