6AF3BEFH

Toxin-antitoxin module from streptococcus pneumoniae
Link type Probability Loop ranges Chain B piercings Chain E piercings Chain F piercings Chain H piercings
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
view details
Hopf.2 U 2 Rings Hopf.2 U 2 Rings 33% -B -8B -117E
Interpreting sequences
Chain B Sequence
NNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLE
Chain B Sequence
MHNIYFYKDKNGNEPVFDYMRELTSKKGKDSRIKLNKINDYIELLSQHGTRAGEPYIKHLDAEIWELRPLRDRILFVAWMDGSFVLLHHFMKRTQKTPKREIEQAKRELADLKERG
Chain B Sequence
NNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPL
Chain B Sequence
SNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLE
sequence length 91,116,90,86
structure length 91,116,90,86
publication title Toxin-Antitoxin module from Streptococcus pneumoniae
rcsb
molecule tags Toxin
molecule keywords HigB toxin
source organism Streptococcus pneumoniae tigr4
pdb deposition date2018-08-08
LinkProt deposition date2019-08-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling