| Link type | Probability | Loop ranges | Chain B piercings | Chain D piercings | Chain F piercings | Chain H piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
| view details |
|
Hopf.2 # Hopf.2 U Ring | 49% | -B | -87F -82H | +56B -85B -94H | ||||||||||
Chain B Sequence |
NNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLE |
Chain B Sequence |
KNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLE |
Chain B Sequence |
NNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPL |
Chain B Sequence |
SNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVPLE |
| sequence length | 91,92,90,86 |
| structure length | 91,92,90,86 |
| publication title |
Toxin-Antitoxin module from Streptococcus pneumoniae
rcsb |
| molecule tags | Toxin |
| molecule keywords | HigB toxin |
| source organism | Streptococcus pneumoniae tigr4 |
| pdb deposition date | 2018-08-08 |
| LinkProt deposition date | 2019-08-16 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
